TEAD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23380325UL

Catalog No. NB397340

Description

TEAD4 Polyclonal specifically detects TEAD4 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TEAD4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q15561
• Gene Symbols: TEAD4
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGP
• Quantity: 25 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 7004
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EFTR-2, hRTEF-1B, related transcription enhancer factor 1B, RTEF1RTEF-1, TCF13L1MGC9014, TEA domain family member 4TEF3, TEAD-4, TEF-3, TEFR-1, Transcription factor 13-like 1, Transcription factor RTEF-1, transcriptional enhancer factor 1-related, transcriptional enhancer factor 3, transcriptional enhancer factor TEF-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only