Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TEKT3 Antibody, Novus Biologicals™

TEKT3 Antibody, Novus Biologicals™
SDP

Catalog No. NB7418120UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB7418120UL 20 μL
NBP174181 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB7418120UL Supplier Novus Biologicals Supplier No. NBP17418120UL

Description

Rabbit Polyclonal Antibody

TEKT3 Polyclonal specifically detects TEKT3 in Rat samples. It is validated for Western Blot.

Specifications

Antigen TEKT3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q4V8G8
Gene Alias FLJ32828, tektin 3, tektin-3, testicular microtubules-related protein
Gene Symbols TEKT3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Tekt3. Immunizing peptide sequence MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ.
Molecular Weight of Antigen 54 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64518
Target Species Rat
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.