TERT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256116

Catalog No. NBP256116

Description

TERT Polyclonal specifically detects TERT in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: TERT
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL
• Gene Alias: EST2Telomerase-associated protein 2, hEST2, TCS1EC 2.7.7.49, Telomerase catalytic subunit, telomerase reverse transcriptase, TP2HEST2, TRTEC 2.7.7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: TERT
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS
• Quantity: 100 μL
• Research Discipline: Autophagy, Cancer, Cellular Markers, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Embryonic Stem Cell Markers, Mitophagy, Stem Cell Markers
• Gene ID (Entrez): 7015
• Target Species: Human
• Isotype: IgG

For Research Use Only