Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Testis expressed 38 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317629100UL
This item is not returnable.
View return policy
Description
Testis expressed 38 Polyclonal antibody specifically detects Testis expressed 38 in Human samples. It is validated for ImmunofluorescenceSpecifications
Testis expressed 38 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
Rabbit | |
Affinity purified | |
RUO | |
374973 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
This antibody was developed against Recombinant Protein corresponding to amino acids: HWRKNLRREEHAQQWVEVMRAATFTYSPLLYWINKRRRYGMNAAINTGPAPAVTKTETEVQNPDVLWDLD | |
100 μg | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction