Tetraspanin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159438

Catalog No. NBP159438

Description

Tetraspanin-4 Polyclonal specifically detects Tetraspanin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: Tetraspanin-4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Rat: 92%; Xenopus: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: O14817
• Gene Symbols: TSPAN4
• Immunogen: Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405).
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7106
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.