Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Tetraspanin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159438
Description
Tetraspanin-4 Polyclonal specifically detects Tetraspanin-4 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
| Tetraspanin-4 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Novel antigen 2, TETRASPAN, tetraspanin 4, tetraspanin-4, Transmembrane 4 superfamily member 7NAG-2NAG2TM4SF7tetraspan TM4SF, TSPAN-4 | |
| Rabbit | |
| 26 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Rat: 92%; Xenopus: 76%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin | |
| O14817 | |
| TSPAN4 | |
| Synthetic peptides corresponding to TSPAN4 (tetraspanin 4) The peptide sequence was selected from the middle region of TSPAN4) Peptide sequence YTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDW (NP_001020405). | |
| Affinity purified | |
| RUO | |
| 7106 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction