Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Tex14 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Tex14 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB123543 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB123543 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB123543 Supplier Novus Biologicals Supplier No. NBP309321100UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Tex14 Polyclonal specifically detects Tex14 in Human samples. It is validated for Western Blot.

Specifications

Antigen Tex14
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias cancer/testis antigen 113, CT113, Protein kinase-like protein SgK307, SGK307, Sugen kinase 307, testis expressed 14, testis expressed sequence 14, testis-expressed protein 14, Testis-expressed sequence 14
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human Tex14 (NP_938207). Peptide sequence TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 56155
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.