Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TFB2M Antibody, Novus Biologicals™
SDP

Catalog No. NBP182114 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP182114 0.1 mL
NB433490 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP182114 Supplier Novus Biologicals Supplier No. NBP182114
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

TFB2M Polyclonal specifically detects TFB2M in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TFB2M
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9H5Q4
Gene Alias dimethyladenosine transferase 2, mitochondrial, EC 2.1.1.-, FLJ22661, FLJ23182, HCV NS5A-transactivated protein 5, Hepatitis C virus NS5A-transactivated protein 5, Hkp1, h-mtTFB, h-mtTFB2, hTFB2M, Mitochondrial 12S rRNA dimethylase 2, Mitochondrial transcription factor B2, mtTFB2, NS5ATP5, S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2, transcription factor B2, mitochondrial
Gene Symbols TFB2M
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIK
Molecular Weight of Antigen 45 kDa
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 64216
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.