Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGN46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP186948
Description
TGN46 Polyclonal specifically detects TGN46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TGN46 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
TGN 46, TGN 48, TGN 51, TGN38, TGN-38, TGN38 homolog, TGN46, TGN-46, TGN48, TGN51, TGOLN 2, TGOLN2, trans golgi network 38, trans golgi network 46, Trans Golgi network integral membrane protein 2, Trans Golgi network integral membrane protein 2 [Precursor], Trans Golgi network protein (46 48 51kD isoforms), Trans golgi network protein 2, Trans Golgi network protein TGN51, Trans-Golgi network integral membrane protein 2, Trans-Golgi network protein 2, Trans-Golgi network protein TGN51, TTGN 2, TTGN2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TGOLN2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS | |
0.1 mL | |
Golgi Apparatus Markers, Trans golgi Network Markers | |
10618 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction