Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TGN46 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TGN46 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TGN46 Polyclonal specifically detects TGN46 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
TGN46 | |
Polyclonal | |
Rabbit | |
Golgi Apparatus Markers, Trans golgi Network Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
10618 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KDVPNKSGAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSWKDHSKPISNPSDNKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSAS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
Unconjugated | |
RUO | |
Human | |
TGN 46, TGN 48, TGN 51, TGN38, TGN-38, TGN38 homolog, TGN46, TGN-46, TGN48, TGN51, TGOLN 2, TGOLN2, trans golgi network 38, trans golgi network 46, Trans Golgi network integral membrane protein 2, Trans Golgi network integral membrane protein 2 [Precursor], Trans Golgi network protein (46 48 51kD isoforms), Trans golgi network protein 2, Trans Golgi network protein TGN51, Trans-Golgi network integral membrane protein 2, Trans-Golgi network protein 2, Trans-Golgi network protein TGN51, TTGN 2, TTGN2 | |
TGOLN2 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title