Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THEG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$492.89
Specifications
| Antigen | THEG |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THEG Polyclonal specifically detects THEG in Human samples. It is validated for Western Blot.Specifications
| THEG | |
| Polyclonal | |
| Rabbit | |
| NP_954672 | |
| 51298 | |
| Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CT56Cancer/testis antigen 56, MGC26138, testis-specific, Theg homolog, Theg homolog (mouse) | |
| THEG | |
| IgG | |
| 41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title