Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                    THEG Antibody, Novus Biologicals™
                                    
                                    
                                    
                                    
                                
                            
                            
                            
                            
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179693
Description
THEG Polyclonal specifically detects THEG in Human samples. It is validated for Western Blot.Specifications
| THEG | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CT56Cancer/testis antigen 56, MGC26138, testis-specific, Theg homolog, Theg homolog (mouse) | |
| Rabbit | |
| 41 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 85%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Guinea Pig | |
| IgG | 
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_954672 | |
| THEG | |
| Synthetic peptide directed towards the middle region of human THEG. Peptide sequence: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV | |
| Affinity purified | |
| RUO | |
| 51298 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | 
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            Spot an opportunity for improvement?Share a Content Correction