Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THG1L Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | THG1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP174219
|
Novus Biologicals
NBP174219 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
THG1L Polyclonal specifically detects THG1L in Mouse samples. It is validated for Western Blot.Specifications
| THG1L | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| EC 2.7.7, EC 2.7.7.6, FLJ11601, FLJ20546, ICF45EC 2.7.7.-, Interphase cytoplasmic foci protein 45, probable tRNA(His) guanylyltransferase, tRNA-histidine guanylyltransferase, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) | |
| THG1L | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9CY52 | |
| 54974 | |
| Synthetic peptides corresponding to the N terminal of Thg1l. Immunizing peptide sequence RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title