Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
THG1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | THG1L |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
THG1L Polyclonal specifically detects THG1L in Mouse samples. It is validated for Western Blot.Specifications
| THG1L | |
| Polyclonal | |
| Rabbit | |
| Q9CY52 | |
| 54974 | |
| Synthetic peptides corresponding to the N terminal of Thg1l. Immunizing peptide sequence RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.7.7, EC 2.7.7.6, FLJ11601, FLJ20546, ICF45EC 2.7.7.-, Interphase cytoplasmic foci protein 45, probable tRNA(His) guanylyltransferase, tRNA-histidine guanylyltransferase, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae) | |
| THG1L | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title