THG1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174219

Catalog No. NBP174219

Description

THG1L Polyclonal specifically detects THG1L in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: THG1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.7.7, EC 2.7.7.6, FLJ11601, FLJ20546, ICF45EC 2.7.7.-, Interphase cytoplasmic foci protein 45, probable tRNA(His) guanylyltransferase, tRNA-histidine guanylyltransferase, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Xenopus: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9CY52
• Gene Symbols: THG1L
• Immunogen: Synthetic peptides corresponding to the N terminal of Thg1l. Immunizing peptide sequence RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF.
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 54974
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.