Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

THG1L Antibody, Novus Biologicals™
SDP

Catalog No. NBP174219 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP174219 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP174219 Supplier Novus Biologicals Supplier No. NBP174219
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

THG1L Polyclonal specifically detects THG1L in Mouse samples. It is validated for Western Blot.

Specifications

Antigen THG1L
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9CY52
Gene Alias EC 2.7.7, EC 2.7.7.6, FLJ11601, FLJ20546, ICF45EC 2.7.7.-, Interphase cytoplasmic foci protein 45, probable tRNA(His) guanylyltransferase, tRNA-histidine guanylyltransferase, tRNA-histidine guanylyltransferase 1-like (S. cerevisiae)
Gene Symbols THG1L
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Thg1l. Immunizing peptide sequence RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 54974
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Xenopus: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.