Thioredoxin-like 5/TRP14/TXNDC17 Antibody, Novus Biologicals™

Catalog No.	Quantity
NB433921	25ul
NBP181204	0.1 mL

Catalog No. NB433921 Supplier Novus Biologicals Supplier No. NBP18120425UL

Description

Rabbit Polyclonal Antibody

Thioredoxin-like 5/TRP14/TXNDC17 Polyclonal specifically detects Thioredoxin-like 5/TRP14/TXNDC17 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Thioredoxin-like 5/TRP14/TXNDC17
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200-1:500
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q9BRA2, Q9BRA2, Q9BRA2, Q9BRA2
• Gene Alias: MGC14353, Protein 42-9-9, thioredoxin (Trx)-related protein, 14 kDa, thioredoxin domain containing 17, thioredoxin domain-containing protein 17, thioredoxin-like 5, Thioredoxin-like protein 5, TRP1414 kDa thioredoxin-related protein, TXNL5
• Gene Symbols: TXNDC17
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISE
• Purification Method: Affinity Purified
• Quantity: 25ul
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 84817
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only