Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thioredoxin Reductase 1/TRXR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255363
Description
Thioredoxin Reductase 1/TRXR1 Polyclonal specifically detects Thioredoxin Reductase 1/TRXR1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Thioredoxin Reductase 1/TRXR1 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TXNRD1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML | |
100 μL | |
Breast Cancer, Lipid and Metabolism | |
7296 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction