Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Thioredoxin Reductase 1/TRXR1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP255363 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255363 100 μL
NB435578 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP255363 Supplier Novus Biologicals Supplier No. NBP255363
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Thioredoxin Reductase 1/TRXR1 Polyclonal specifically detects Thioredoxin Reductase 1/TRXR1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen Thioredoxin Reductase 1/TRXR1
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1
Gene Symbols TXNRD1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 7296
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.