Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thioredoxin Reductase 1/TRXR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | Thioredoxin Reductase 1/TRXR1 |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Thioredoxin Reductase 1/TRXR1 Polyclonal specifically detects Thioredoxin Reductase 1/TRXR1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
Thioredoxin Reductase 1/TRXR1 | |
Polyclonal | |
Rabbit | |
Breast Cancer, Lipid and Metabolism | |
EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1 | |
TXNRD1 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
7296 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title