Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Thrombopoietin/THPO Antibody, Novus Biologicals™

Thrombopoietin/THPO Antibody, Novus Biologicals™
SDP

Catalog No. NBP159293 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159293 100 μL
NBP15929320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159293 Supplier Novus Biologicals Supplier No. NBP159293
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Thrombopoietin/THPO Polyclonal specifically detects Thrombopoietin/THPO in Human samples. It is validated for Western Blot, ELISA.

Specifications

Antigen Thrombopoietin/Tpo
Applications Western Blot, ELISA
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, ELISA 1:100-1:2000
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P40225
Gene Alias Megakaryocyte colony-stimulating factor, Megakaryocyte growth and development factor, megakaryocyte stimulating factor, MGDFC-mpl ligand, ML, MPL ligand, MPLLGMGC163194, Myeloproliferative leukemia virus oncogene ligand, thrombopoietin, thrombopoietin nirs variant 1, TPOMKCSF
Gene Symbols THPO
Host Species Rabbit
Immunogen Synthetic peptides corresponding to THPO(thrombopoietin (myeloproliferative leukemia virus oncogene ligand, megakaryocyte growth and development factor)) The peptide sequence was selected from the middle region of THPO. Peptide sequence NLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTS The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 35 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cellular Markers, Cytokine Research, Hematopoietic Stem Cell Markers, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 7066
Test Specificity Expected identity based on immunogen sequence: Cat: 100%; Human: 100%; Canine: 83%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Canine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.