Thymopoietin/LAP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159402

Catalog No. NBP159402

Description

Thymopoietin/LAP2 Polyclonal specifically detects Thymopoietin/LAP2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Thymopoietin/LAP2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CMD1T, lamina-associated polypeptide 2, LAP2PRO0868, LEM domain containing 4, LEMD4, MGC61508, thymopoietin, Thymopoietin isoform alpha, Thymopoietin, isoforms beta/gamma, Thymopoietin-related peptide isoform alpha, Thymopoietin-related peptide isoforms beta/gamma, TP, TP alpha, TP beta/gamma, TPRP isoform alpha, TPRP isoforms beta/gamma
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Bovine: 92%; Chicken: 92%; Canine: 92%; Equine: 92%; Pig: 92%; Xenopus: 85%; Guinea pig: 85%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P42167-2
• Gene Symbols: TMPO
• Immunogen: Synthetic peptides corresponding to TMPO(thymopoietin) The peptide sequence was selected from the N terminal of TMPO. Peptide sequence MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR.
• Quantity: 100 μL
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 7112
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.