Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Thymopoietin/LAP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Thymopoietin/LAP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Thymopoietin/LAP2 Polyclonal specifically detects Thymopoietin/LAP2 in Human samples. It is validated for Western Blot.Specifications
Thymopoietin/LAP2 | |
Polyclonal | |
Rabbit | |
DNA Repair, DNA replication Transcription Translation and Splicing | |
CMD1T, lamina-associated polypeptide 2, LAP2PRO0868, LEM domain containing 4, LEMD4, MGC61508, thymopoietin, Thymopoietin isoform alpha, Thymopoietin, isoforms beta/gamma, Thymopoietin-related peptide isoform alpha, Thymopoietin-related peptide isoforms beta/gamma, TP, TP alpha, TP beta/gamma, TPRP isoform alpha, TPRP isoforms beta/gamma | |
TMPO | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
P42167-2 | |
7112 | |
Synthetic peptides corresponding to TMPO(thymopoietin) The peptide sequence was selected from the N terminal of TMPO. Peptide sequence MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title