Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Thymopoietin/LAP2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen Thymopoietin/LAP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159402
View Documents
Novus Biologicals
NBP159402
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

Thymopoietin/LAP2 Polyclonal specifically detects Thymopoietin/LAP2 in Human samples. It is validated for Western Blot.
Specifications

Specifications

Thymopoietin/LAP2
Polyclonal
Rabbit
DNA Repair, DNA replication Transcription Translation and Splicing
P42167-2
7112
Synthetic peptides corresponding to TMPO(thymopoietin) The peptide sequence was selected from the N terminal of TMPO. Peptide sequence MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
CMD1T, lamina-associated polypeptide 2, LAP2PRO0868, LEM domain containing 4, LEMD4, MGC61508, thymopoietin, Thymopoietin isoform alpha, Thymopoietin, isoforms beta/gamma, Thymopoietin-related peptide isoform alpha, Thymopoietin-related peptide isoforms beta/gamma, TP, TP alpha, TP beta/gamma, TPRP isoform alpha, TPRP isoforms beta/gamma
TMPO
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit