TIAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Supplier:  Novus Biologicals NBP179932

Catalog No. NBP179932

Description

TIAL1 Polyclonal specifically detects TIAL1 in Human, Zebrafish samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence, In Situ Hybridization (ISH).

Specifications

• Antigen: TIAL1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 7073
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence, In Situ Hybridization (ISH)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence, In-situ Hybridization
• Gene Accession No.: NP_003243
• Gene Symbols: TIAL1
• Immunogen: Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Mouse: 85%; Rat: 85%; Zebrafish: 76%.
• Target Species: Human, Zebrafish, Zebrafish, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified