Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TIAL1 Antibody, Novus Biologicals™

TIAL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179932 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179932 100 μL
NBP17993220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179932 Supplier Novus Biologicals Supplier No. NBP179932
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 4 publications

TIAL1 Polyclonal specifically detects TIAL1 in Human, Zebrafish samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence, In Situ Hybridization (ISH).

Specifications

Antigen TIAL1
Applications Western Blot, Immunocytochemistry, Immunofluorescence, In Situ Hybridization (ISH)
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence, In-situ Hybridization
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_003243
Gene Alias aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR
Gene Symbols TIAL1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ.
Molecular Weight of Antigen 42 kDa
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis
Primary or Secondary Primary
Gene ID (Entrez) 7073
Test Specificity Expected identity based on immunogen sequence: Mouse: 85%; Rat: 85%; Zebrafish: 76%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Zebrafish, Zebrafish, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.