Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIAL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
$206.00 - $501.50
Specifications
| Antigen | TIAL1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17993220
|
Novus Biologicals
NBP17993220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179932
|
Novus Biologicals
NBP179932 |
100 μL |
Each for $501.50
|
|
|||||
Description
TIAL1 Polyclonal specifically detects TIAL1 in Human, Zebrafish samples. It is validated for Western Blot, Immunocytochemistry, Immunofluorescence, In Situ Hybridization (ISH).Specifications
| TIAL1 | |
| Unconjugated | |
| Rabbit | |
| Apoptosis | |
| aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR | |
| TIAL1 | |
| IgG | |
| Protein A purified |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_003243 | |
| 7073 | |
| Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ. | |
| Primary | |
| 42 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title