TIAL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 4 publications

Supplier:  Novus Biologicals NBP17993220UL

Catalog No. NBP17993220

Description

TIAL1 Polyclonal specifically detects TIAL1 in Human, Mouse, Zebrafish samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, In-situ Hybridization.

Specifications

• Antigen: TIAL1
• Classification: Polyclonal
• Dilution: Western Blot 1:1000
• Gene Accession No.: NP_003243
• Gene Symbols: TIAL1
• Immunogen: Synthetic peptide directed towards the C terminal of human TIAL1The immunogen for this antibody is TIAL1. Peptide sequence WNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Zebrafish
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aging-associated gene 7 protein, MGC33401, TCBP, T-cluster binding protein, TIA1 cytotoxic granule-associated RNA binding protein-like 1, TIA1 cytotoxic granule-associated RNA-binding protein-like 1, TIA-1 related protein, TIA-1-related nucleolysin, TIA-1-related protein, TIARnucleolysin TIAR
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 20 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 7073
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG