TICRR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26867425UL

Catalog No. NB392961

Description

TICRR Polyclonal antibody specifically detects TICRR in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: TICRR
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: C15orf42, Chromosome 15 Open Reading Frame 42, SLD3, SLD3 Homolog, SLD3 Homolog (S. Cerevisiae), TOPBP1-Interacting Checkpoint And Replication Regulator, TOPBP1-Interacting Replication-Stimulating Protein, TopBP1-Interacting, Replication-Stimulating Protein, Treslin
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 90381
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified