TID1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP234066

Catalog No. NBP234066

Description

TID1 Polyclonal specifically detects TID1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TID1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q96EY1
• Gene Symbols: DNAJA3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DPEELFRKIFGEFSSSSFGDFQTVFDQPQEYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGTKVQHCHYCGGSGMETINTGPFVMRST
• Quantity: 0.1 mL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 9093
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DnaJ (Hsp40) homolog, subfamily A, member 3, DnaJ protein Tid-1, HCA57, Hepatocellular carcinoma-associated antigen 57, hTid-1FLJ45758, TID1dnaJ homolog subfamily A member 3, mitochondrial, tumorous imaginal discs homolog, Tumorous imaginal discs protein Tid56 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only