Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIF1 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP256418
Description
TIF1 alpha Polyclonal specifically detects TIF1 alpha in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
TIF1 alpha | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Knockdown Validated | |
E3 ubiquitin-protein ligase TRIM24, EC 6.3.2, EC 6.3.2.-, hTIF1, PTC6, RING finger protein 82, RNF82Tif1a, TIF1-alpha, TIF1ATIF1ALPHA, TIF1TF1A, transcription intermediary factor 1-alpha, transcriptional intermediary factor 1, tripartite motif containing 24, tripartite motif-containing 24, Tripartite motif-containing protein 24 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
TRIM24 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK | |
100 μL | |
Protein Kinase, Zinc Finger | |
8805 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction