Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIF1 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | TIF1 alpha |
---|---|
Applications | Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
TIF1 alpha Polyclonal specifically detects TIF1 alpha in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence, Knockdown Validated.Specifications
TIF1 alpha | |
Polyclonal | |
Rabbit | |
Protein Kinase, Zinc Finger | |
E3 ubiquitin-protein ligase TRIM24, EC 6.3.2, EC 6.3.2.-, hTIF1, PTC6, RING finger protein 82, RNF82Tif1a, TIF1-alpha, TIF1ATIF1ALPHA, TIF1TF1A, transcription intermediary factor 1-alpha, transcriptional intermediary factor 1, tripartite motif containing 24, tripartite motif-containing 24, Tripartite motif-containing protein 24 | |
TRIM24 | |
IgG | |
Affinity Purified |
Western Blot, Immunocytochemistry, Immunofluorescence, KnockDown | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
8805 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title