Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TIM-3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16915420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16915420 20 μL
NBP169154 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16915420 Supplier Novus Biologicals Supplier No. NBP16915420UL

Rabbit Polyclonal Antibody

TIM-3 Polyclonal specifically detects TIM-3 in Human samples. It is validated for Western Blot.

Specifications

Antigen TIM-3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8TDQ0
Gene Alias CD366, FLJ14428, HAVcr-2, hepatitis A virus cellular receptor 2, kidney injury molecule-3, T cell immunoglobulin mucin 3, T cell immunoglobulin mucin-3, T-cell immunoglobulin and mucin domain-containing protein 3, TIM 3, Tim-3, TIM3 T-cell membrane protein 3, TIMD-3, TIMD3KIM-3
Gene Symbols HAVCR2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to HAVCR2 (hepatitis A virus cellular receptor 2) The peptide sequence was selected from the C terminal of HAVCR2. Peptide sequence IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL.
Molecular Weight of Antigen 33 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Immunology, Innate Immunity
Primary or Secondary Primary
Gene ID (Entrez) 84868
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.