Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIM-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00
Specifications
| Antigen | TIM-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP16915420
|
Novus Biologicals
NBP16915420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP169154
|
Novus Biologicals
NBP169154 |
100 μL | N/A | N/A | N/A | ||||
Description
TIM-3 Polyclonal specifically detects TIM-3 in Human samples. It is validated for Western Blot.Specifications
| TIM-3 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CD366, FLJ14428, HAVcr-2, hepatitis A virus cellular receptor 2, kidney injury molecule-3, T cell immunoglobulin mucin 3, T cell immunoglobulin mucin-3, T-cell immunoglobulin and mucin domain-containing protein 3, TIM 3, Tim-3, TIM3 T-cell membrane protein 3, TIMD-3, TIMD3KIM-3 | |
| HAVCR2 | |
| IgG | |
| Affinity Purified | |
| 33 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8TDQ0 | |
| 84868 | |
| Synthetic peptides corresponding to HAVCR2 (hepatitis A virus cellular receptor 2) The peptide sequence was selected from the C terminal of HAVCR2. Peptide sequence IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title