Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TIM-3 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Specifications
Antigen | TIM-3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16915420
|
Novus Biologicals
NBP16915420UL |
20 μL |
Each for $152.22
|
N/A |
NBP169154
|
Novus Biologicals
NBP169154 |
100 μL |
Each for $436.00
|
N/A |
Description
TIM-3 Polyclonal specifically detects TIM-3 in Human samples. It is validated for Western Blot.Specifications
TIM-3 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
CD366, FLJ14428, HAVcr-2, hepatitis A virus cellular receptor 2, kidney injury molecule-3, T cell immunoglobulin mucin 3, T cell immunoglobulin mucin-3, T-cell immunoglobulin and mucin domain-containing protein 3, TIM 3, Tim-3, TIM3 T-cell membrane protein 3, TIMD-3, TIMD3KIM-3 | |
HAVCR2 | |
IgG | |
Affinity Purified | |
33 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q8TDQ0 | |
84868 | |
Synthetic peptides corresponding to HAVCR2 (hepatitis A virus cellular receptor 2) The peptide sequence was selected from the C terminal of HAVCR2. Peptide sequence IGIYIGAGICAGLALALIFGALIFKWYSHSKEKIQNLSLISLANLPPSGL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title