Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TIMM13 Antibody, Novus Biologicals™

TIMM13 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17422620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17422620 20 μL
NBP174226 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17422620 Supplier Novus Biologicals Supplier No. NBP17422620UL

Description

Rabbit Polyclonal Antibody

TIMM13 Polyclonal specifically detects TIMM13 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen TIMM13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P62075
Gene Alias mitochondrial import inner membrane translocase subunit Tim13, mitochondrial import inner membrane translocase subunit Tim13B, ppv1, Tim13, TIM13B, TIMM13A, TIMM13B, translocase of inner mitochondrial membrane 13 (yeast) homolog B, translocase of inner mitochondrial membrane 13 homolog (yeast)
Gene Symbols TIMM13
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Timm13. Immunizing peptide sequence FGSDFGGTGGGKLDPGAIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKP.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 26517
Test Specificity This product is specific to Subunit or Isoform: Tim13.
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.