TIMP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23870025UL

Catalog No. NB404645

Description

TIMP-1 Polyclonal specifically detects TIMP-1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TIMP-1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P01033
• Gene Symbols: TIMP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ
• Quantity: 25 μL
• Research Discipline: Angiogenesis, Cancer, Cell Biology, Cell Cycle and Replication, Cellular Markers, Cytoskeleton Markers, Extracellular Matrix
• Gene ID (Entrez): 7076
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CLGI, Collagenase inhibitor, collagenase inhibitor), EPATIMP-1, EPO, erythroid potentiating activity, Erythroid-potentiating activity, Fibroblast collagenase inhibitor, FLJ90373, HCI, metalloproteinase inhibitor 1, TIMP metallopeptidase inhibitor 1, TIMPtissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, Tissue inhibitor of metalloproteinases 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.