Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16919720

TIMP-3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16919720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16919720 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16919720 Supplier Novus Biologicals Supplier No. NBP16919720UL

Description

Rabbit Polyclonal Antibody

TIMP-3 Polyclonal specifically detects TIMP-3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TIMP-3
Applications Western Blot, Immunohistochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml, Immunohistochemistry
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P48032
Gene Alias HSMRK222, K222, K222TA2, metalloproteinase inhibitor 3, MIG-5 protein, Protein MIG-5, pseudoinflammatory), SFD, TIMP metallopeptidase inhibitor 3, TIMP-3, tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy, Tissue inhibitor of metalloproteinases 3
Gene Symbols TIMP3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TIMP3 (TIMP metallopeptidase inhibitor 3) The peptide sequence was selected form the middle region of TIMP3. Peptide sequence LVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKY.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Cancer, Hypoxia, Vision
Primary or Secondary Primary
Gene ID (Entrez) 7078
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.