Learn More
Description
Specifications
Specifications
| Antigen | TIP60 |
| Applications | Western Blot, Immunocytochemistry |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | cPLA2, ESA1EC 2.3.1.48, Histone acetyltransferase HTATIP, histone acetyltransferase KAT5, HIV-1 Tat interactive protein, HIV-1 Tat interactive protein, 60kDa, HTATIP1, HTATIPcPLA2 interacting protein, K(lysine) acetyltransferase 5,60 kDa Tat-interactive protein, K-acetyltransferase 5, Lysine acetyltransferase 5, PLIPTIP, Tat interacting protein, 60kDa, Tip60, TIP60cPLA(2)-interacting protein |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein TIP60 using the following amino acid sequence: YWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKR |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
