Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
For use in research applications
$706.00 - $1452.00
Specifications
| Host Species | Human, Mouse |
|---|---|
| Components | TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. |
| For Use With (Application) | Inhibition of TIRAP binding to TLR2 or TLR4 |
| Content And Storage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Product Type | TIRAP (TLR2 and TLR4) Inhibitor Peptide Set |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP229331
|
Novus Biologicals™
NBP229331 |
2 mg |
Each for $706.00
|
|
|||||
|
NBP2293315
|
Novus Biologicals™
NBP2293315MG |
5 mg |
Each for $1,452.00
|
|
|||||
Specifications
| Human, Mouse | |
| Inhibition of TIRAP binding to TLR2 or TLR4 | |
| TIRAP (TLR2 and TLR4) Inhibitor Peptide Set | |
| TLR2, TLR4 |
| TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| 3701.4 | |
| Lyophilized |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title