TKTL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155173

Catalog No. NBP155173

Description

TKTL2 Polyclonal specifically detects TKTL2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TKTL2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZP434L1717, EC 2.2.1.1, FLJ32975, transketolase-like 2, transketolase-like protein 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H0I9
• Gene Symbols: TKTL2
• Immunogen: Synthetic peptides corresponding to TKTL2(transketolase-like 2) The peptide sequence was selected from the C terminal of TKTL2. Peptide sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84076
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG