Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TKTL2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | TKTL2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
TKTL2 Polyclonal specifically detects TKTL2 in Human samples. It is validated for Western Blot.Specifications
TKTL2 | |
Polyclonal | |
Purified | |
RUO | |
DKFZP434L1717, EC 2.2.1.1, FLJ32975, transketolase-like 2, transketolase-like protein 2 | |
TKTL2 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q9H0I9 | |
84076 | |
Synthetic peptides corresponding to TKTL2(transketolase-like 2) The peptide sequence was selected from the C terminal of TKTL2. Peptide sequence SSAKATGGRVITVEDHYREGGIGEAVCAAVSREPDILVHQLAVSGVPQRG. | |
Primary | |
68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title