TLX/NR2E1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310924100UL

Catalog No. NB126747

Description

TLX/NR2E1 Polyclonal specifically detects TLX/NR2E1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

• Antigen: TLX/NR2E1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry
• Gene Alias: hTll, nuclear receptor subfamily 2, group E, member 1, Nuclear receptor TLX, Protein tailless homolog, tailes-related receptor, tailless homolog, Tll, TLXnuclear receptor subfamily 2 group E member 1, XTLL
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TLX/NR2E1 (NP_003260). Peptide sequence MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
• Quantity: 100 μg
• Research Discipline: Neuroscience
• Gene ID (Entrez): 7101
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified