Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TLX/NR2E1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	TLX/NR2E1
Dilution	Western Blot 1.0 ug/ml, Immunohistochemistry
Applications	Western Blot, Immunohistochemistry
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB126747 View Documents View Product Certificates	Novus Biologicals NBP310924100UL	100 μg	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

TLX/NR2E1 Polyclonal specifically detects TLX/NR2E1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen	TLX/NR2E1
Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Neuroscience
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	7101
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 1.0 ug/ml, Immunohistochemistry
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	hTll, nuclear receptor subfamily 2, group E, member 1, Nuclear receptor TLX, Protein tailless homolog, tailes-related receptor, tailless homolog, Tll, TLXnuclear receptor subfamily 2 group E member 1, XTLL
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human TLX/NR2E1 (NP_003260). Peptide sequence MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

TLX/NR2E1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents