TM4SF1/L6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18285425UL

Catalog No. NB407013

Description

TM4SF1/L6 Polyclonal specifically detects TM4SF1/L6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TM4SF1/L6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: L6, M3S1Tumor-associated antigen L6, Membrane component chromosome 3 surface marker 1, membrane component, chromosome 3, surface marker 1, TAAL6H-L6, transmembrane 4 L six family member 1, transmembrane 4 L6 family member 1, transmembrane 4 superfamily member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 4071
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.1mg/mL
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P30408
• Gene Symbols: TM4SF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only