Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM4SF1/L6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP182854
Description
TM4SF1/L6 Polyclonal specifically detects TM4SF1/L6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TM4SF1/L6 | |
Polyclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
L6, M3S1Tumor-associated antigen L6, Membrane component chromosome 3 surface marker 1, membrane component, chromosome 3, surface marker 1, TAAL6H-L6, transmembrane 4 L six family member 1, transmembrane 4 L6 family member 1, transmembrane 4 superfamily member 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
4071 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.1mg/mL | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
P30408 | |
TM4SF1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction