Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM4SF1/L6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | TM4SF1/L6 |
---|---|
Concentration | 0.1mg/mL |
Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
TM4SF1/L6 Polyclonal specifically detects TM4SF1/L6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TM4SF1/L6 | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
P30408 | |
4071 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:GPLCLDSLGQWNYTFASTEGQYLLDTSTWSECTEPKHIVEWNVSLFSI | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
0.1mg/mL | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
L6, M3S1Tumor-associated antigen L6, Membrane component chromosome 3 surface marker 1, membrane component, chromosome 3, surface marker 1, TAAL6H-L6, transmembrane 4 L six family member 1, transmembrane 4 L6 family member 1, transmembrane 4 superfamily member 1 | |
TM4SF1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title