TM4SF20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159848

Catalog No. NBP159848

Description

TM4SF20 Polyclonal specifically detects TM4SF20 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TM4SF20
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ22800, PRO994, TCCE518, transmembrane 4 L six family member 20, transmembrane 4 L6 family member 20
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rat 83%, Rabbit 83%.
• Target Species: Human, Rat, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q53R12
• Gene Symbols: TM4SF20
• Immunogen: Synthetic peptides corresponding to TM4SF20 (transmembrane 4 L six family member 20) The peptide sequence was selected from the middle region of TM4SF20)(50ug). Peptide sequence QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79853
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.