TM7SF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180548

Catalog No. NBP180548

Description

TM7SF2 Polyclonal specifically detects TM7SF2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TM7SF2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ANG1, C-14 sterol reductase, delta(14)-sterol reductase, delta-14-SR, DHCR14A, NET47, putative sterol reductase SR-1, sterol C14-reductase, transmembrane 7 superfamily member 2
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 7108
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_003264
• Gene Symbols: TM7SF2
• Immunogen: Synthetic peptide directed towards the N terminal of human TM7SF2. Peptide sequence LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Goat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG