Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM9SF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | TM9SF1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP162532
![]() |
Novus Biologicals
NBP162532 |
100 μL |
Each for $480.74
|
|
|||||
NBP16253220
![]() |
Novus Biologicals
NBP16253220UL |
20 μL | N/A | N/A | N/A | ||||
Description
TM9SF1 Polyclonal specifically detects TM9SF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TM9SF1 | |
| Polyclonal | |
| Purified | |
| RUO | |
| HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1 | |
| TM9SF1 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| O15321 | |
| 10548 | |
| Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the middle region of TM9SF1. Peptide sequence THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV. | |
| Primary | |
| 67 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title