Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TM9SF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | TM9SF1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP16253220
![]() |
Novus Biologicals
NBP16253220UL |
20 μL |
Each for $206.00
|
|
|||||
NBP162532
![]() |
Novus Biologicals
NBP162532 |
100 μL |
Each for $487.50
|
|
|||||
Description
TM9SF1 Polyclonal specifically detects TM9SF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
TM9SF1 | |
Polyclonal | |
Purified | |
RUO | |
HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1 | |
TM9SF1 | |
IgG | |
Protein A purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
O15321 | |
10548 | |
Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the middle region of TM9SF1. Peptide sequence THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV. | |
Primary | |
67 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title