TM9SF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16253220UL

Catalog No. NBP16253220

Description

TM9SF1 Polyclonal specifically detects TM9SF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TM9SF1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: O15321
• Gene Symbols: TM9SF1
• Immunogen: Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the middle region of TM9SF1. Peptide sequence THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10548
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified