Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

TM9SF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16253220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16253220 20 μL
NBP162532 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16253220 Supplier Novus Biologicals Supplier No. NBP16253220UL

Rabbit Polyclonal Antibody

TM9SF1 Polyclonal specifically detects TM9SF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen TM9SF1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O15321
Gene Alias HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1
Gene Symbols TM9SF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to TM9SF1(transmembrane 9 superfamily member 1) The peptide sequence was selected from the middle region of TM9SF1. Peptide sequence THTYSVRWSETSVERRSDRRRGDDGGFFPRTLEIHWLSIINSMVLVFLLV.
Molecular Weight of Antigen 67 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10548
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.