TM9SF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23244525UL

Catalog No. NB397501

Description

TM9SF1 Polyclonal specifically detects TM9SF1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TM9SF1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: HMP70, MP70, MP70 protein family member, multispanning membrane protein (70kD), transmembrane 9 superfamily member 1, transmembrane protein 9 superfamily member 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10548
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TM9SF1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: RVLRNDLARYNLDEETTSAGSGDDFDQGDNGWKIIHTDVFRFP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only