TM9SF4 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159965	100 μL

Catalog No. NBP159965 Supplier Novus Biologicals Supplier No. NBP159965

Description

Rabbit Polyclonal Antibody

TM9SF4 Polyclonal specifically detects TM9SF4 in Human samples. It is validated for Western Blot, Flow Cytometry.

Specifications

• Antigen: TM9SF4
• Applications: Western Blot, Flow Cytometry
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Flow Cytometry
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q92544
• Gene Alias: KIAA0255dJ836N17.2, transmembrane 9 superfamily member 4, transmembrane 9 superfamily protein member 4
• Gene Symbols: TM9SF4
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to TM9SF4(transmembrane 9 superfamily protein member 4) The peptide sequence was selected from the N terminal of TM9SF4 (NP_055557). Peptide sequence HQNDPVEIKAVKLTSSRTQLPYEYYSLPFCQPSKITYKAENLGEVLRGDR.
• Molecular Weight of Antigen: 72 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 9777
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%; Xenopus: 92%; Human: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only