TMCO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159980

Catalog No. NBP159980

Description

TMCO1 Polyclonal specifically detects TMCO1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMCO1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: HP10122, PCIA3, PNAS-136, putative membrane protein, RP11-466F5.7, TMCC4, transmembrane and coiled-coil domain-containing protein 1, transmembrane and coiled-coil domains 1, transmembrane and coiled-coil domains 4, Transmembrane and coiled-coil domains protein 4, Xenogeneic cross-immune protein PCIA3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54499
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UM00
• Gene Symbols: TMCO1
• Immunogen: Synthetic peptides corresponding to TMCO1(transmembrane and coiled-coil domains 1) The peptide sequence was selected from the C terminal of TMCO1. Peptide sequence CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Xenopus: 85%; Chicken: 85%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only