TMCO1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP159980	100 μL

Catalog No. NBP159980 Supplier Novus Biologicals Supplier No. NBP159980

Description

Rabbit Polyclonal Antibody

TMCO1 Polyclonal specifically detects TMCO1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: TMCO1
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q9UM00
• Gene Alias: HP10122, PCIA3, PNAS-136, putative membrane protein, RP11-466F5.7, TMCC4, transmembrane and coiled-coil domain-containing protein 1, transmembrane and coiled-coil domains 1, transmembrane and coiled-coil domains 4, Transmembrane and coiled-coil domains protein 4, Xenogeneic cross-immune protein PCIA3
• Gene Symbols: TMCO1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to TMCO1(transmembrane and coiled-coil domains 1) The peptide sequence was selected from the C terminal of TMCO1. Peptide sequence CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 54499
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Xenopus: 85%; Chicken: 85%; Zebrafish: 78%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only