Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCO3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179207
Description
TMCO3 Polyclonal specifically detects TMCO3 in Mouse samples. It is validated for Western Blot.Specifications
TMCO3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
B230339H12Rik, C13orf11, chromosome 13 open reading frame 11, FLJ20623, Putative LAG1-interacting protein, transmembrane and coiled-coil domain-containing protein 3, transmembrane and coiled-coil domains 3 | |
Rabbit | |
Affinity purified | |
RUO | |
55002 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_758486 | |
TMCO3 | |
The immunogen for this antibody is Tmco3. Peptide sequence MLIDSQNNQYILTKPRDSTIPRADHHFIKDIVTIGMLSLPCGWLCTAIGL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Chicken: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Rabbit: 92%; Zebrafish: 92%; Bovine: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction