Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
TMCO4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16890720UL
Description
TMCO4 Polyclonal specifically detects TMCO4 in Human samples. It is validated for Western Blot.Specifications
TMCO4 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q5TGY1 | |
TMCO4 | |
Synthetic peptides corresponding to TMCO4 (transmembrane and coiled-coil domains 4) The peptide sequence was selected from the C terminal of TMCO4. Peptide sequence WPASLLSVANVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFS. | |
Affinity Purified | |
RUO | |
255104 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp686C23231, RP5-1056L3.6, transmembrane and coiled-coil domain-containing protein 4, transmembrane and coiled-coil domains 4 | |
Rabbit | |
68 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction